PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G16720.1
Common NameATMYB7, ATY49, MYB7, Y49
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 269aa    MW: 31009.3 Da    PI: 8.7736
Description myb domain protein 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G16720.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv ++k +G g+W++ +r  g+ R++k+c++rw +yl
      AT2G16720.1 14 KGAWTKEEDERLVSYIKSHGEGCWRSLPRAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding57.62.9e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T +Edel+++++ +lG++ W++Ia++++ gRt++++k++w+++
      AT2G16720.1  67 RGNFTHDEDELIIKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.094961IPR017930Myb domain
SuperFamilySSF466891.8E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002493.6E-151461IPR001005SANT/Myb domain
CDDcd001672.51E-91661No hitNo description
PROSITE profilePS5129428.75162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-2865116IPR009057Homeodomain-like
SMARTSM007173.2E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1667111IPR001005SANT/Myb domain
CDDcd001675.75E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:1900384Biological Processregulation of flavonol biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRSPCCEKE HMNKGAWTKE EDERLVSYIK SHGEGCWRSL PRAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF THDEDELIIK LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLLSKG  120
IDPATHRGIN EAKISDLKKT KDQIVKDVSF VTKFEETDKS GDQKQNKYIR NGLVCKEERV  180
VVEEKIGPDL NLELRISPPW QNQREISTCT ASRFYMENDM ECSSETVKCQ TENSSSISYS  240
SIDISSSNVG YDFLGLKTRI LDFRSLEMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.53490.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865008250.0
Genevisible265359_at0.0
Expression AtlasAT2G16720-
AtGenExpressAT2G16720-
ATTED-IIAT2G16720-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of MYB3R- and R2R3- type MYB- encoding genes
Function -- GeneRIF ? help Back to Top
  1. AtMyb7 negatively controls the expression of the gene encoding bZIP transcription factor, ABI5, which is a key transcription factor in abscisic acid (ABA) signalling and serves as a crucial regulator of germination inhibition in Arabidopsis.
    [PMID: 25053018]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G16720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G16720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU269370.0U26937.1 Arabidopsis thaliana clone myb7 DNA-binding protein mRNA, complete cds.
GenBankAY5195730.0AY519573.1 Arabidopsis thaliana MYB transcription factor (At2g16720) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179263.10.0myb domain protein 7
SwissprotO496081e-117MYB32_ARATH; Transcription factor MYB32
TrEMBLQ423790.0Q42379_ARATH; DNA-binding protein
STRINGAT2G16720.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  5. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]
  6. Ma S,Bohnert HJ
    Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression.
    Genome Biol., 2007. 8(4): p. R49
    [PMID:17408486]
  7. Catala R, et al.
    The Arabidopsis E3 SUMO ligase SIZ1 regulates plant growth and drought responses.
    Plant Cell, 2007. 19(9): p. 2952-66
    [PMID:17905899]
  8. Dubos C, et al.
    MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana.
    Plant J., 2008. 55(6): p. 940-53
    [PMID:18532978]
  9. Huang D,Wu W,Abrams SR,Cutler AJ
    The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors.
    J. Exp. Bot., 2008. 59(11): p. 2991-3007
    [PMID:18552355]
  10. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  11. Fornal
    AtMYB7, a new player in the regulation of UV-sunscreens in Arabidopsis thaliana.
    Plant Cell Physiol., 2014. 55(3): p. 507-16
    [PMID:24319076]
  12. Kim JH, et al.
    AtMyb7, a subgroup 4 R2R3 Myb, negatively regulates ABA-induced inhibition of seed germination by blocking the expression of the bZIP transcription factor ABI5.
    Plant Cell Environ., 2015. 38(3): p. 559-71
    [PMID:25053018]
  13. Li SF,Parish RW
    Isolation of two novel myb-like genes from Arabidopsis and studies on the DNA-binding properties of their products.
    Plant J., 1995. 8(6): p. 963-72
    [PMID:8580966]
  14. Quaedvlieg N, et al.
    Identification of a light-regulated MYB gene from an Arabidopsis transcription factor gene collection.
    Plant Mol. Biol., 1996. 32(5): p. 987-93
    [PMID:8980549]
  15. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]